Please contact us for any questions or request for reagents.

Materials and Methods: AMPKA2 (2H6D)

Click on the iSee icon to launch an enhanced annotation with interactive 3D representations and animated transitions. Please note that a web plugin (activeICM) is required to access this enhanced functionality. Instructions for the installation and use of the web plugin are available.

StructureAMPKA2
PDB Code2H6D
Entry clone accessionNP_006243
Entry clone sourceampka2.006.279; plate SDC062:G8
TagmgsshhhhhhssglvprGS
Construct sequencegsKHDGRVKIGHYVLGDTLGVGTFGKVKIGEHQLTGHKVAVKILNRQKIRSLDVVGKIKREIQNLKLFRHPHIIKLYQVISTPTDFFMVMEYVSGGELFDYICKHGRVEEMEARRLFQQILSAVDYC
HRHMVVHRDLKPENVLLDAHMNAKIADFGLSNMMSDGEFLRTSCGSPNYAAPEVISGRLYAGPEVDIWSCGVILYALLCGTLPFDDEHVPTLFKKIRGGVFYIPEYLNRSVATLLMHMLQVDPLKRA
TIKDIREHEWFKQDLPSYLFPE
Vectorp28a-thrombin-lic
Expression hostBL21 (DE3)
Growth mediumTerrific Broth (TB)
Growth methodThe host was grown in Terrific Broth (TB) in the presence of kanamycin (50 µg/mL). A stab culture was taken from glycerol stocks and inoculated into 100mL of LB with 50ug/mL kanamycin in a 250mL flask and incubated with shaking at 250rpm overnight at 37 ºC. The culture was transfered into 1.8L TB with 50ug/mL kanamycin and 0.6mL of antiforam (Sigma) in 2L bottles and cultured using the LEX system to an OD600 of 4.0-5.0 before induction. The culture was adjusted to 15ºC and isopropyl-1-thio-D-galactopyranoside (IPTG) was added to 100ug/mL then incubated overnight at 15ºC before harvesting by centrifugation and storage at -80ºC.
Extraction buffersBinding buffer: 50mM Tris, 0.5M NaCl, 0.5mM TCEP pH 8.0
Extraction procedureThe cell-pellet was thawed, then resuspended in 50mL of binding buffer containing Sigma\'s protease inhibitor cocktail (P2714-1BTL). The thawed cells were homogenized using an Ultra-Turrax T8 homogenizer (IKA Works) at maximal setting for 30-60 seconds. The cells were then lysed by sonication (Virtis408912, Virsonic) on ice with a 10 seconds pulse at half-maximal frequency then 10 seconds rest for a total of 5 minutes sonication time. The resulting lysate was then centrifuged at 63000 xg for 30 minutes at 10 ºC.
Purification buffersWash buffer: 50mM Tris-pH 8.0, 500mM NaCl, 20mM Imidazole, 0.5mM TCEP.
Thrombin cleavage buffer: 20mM Tris-pH 8.4, 150mM NaCl, 2.5mM CaCl2, 0.5mM TCEP
Gel filtration buffer: 50mM Tris-pH 8.0, 500mM NaCl, 0.5mM TCEP
Purification procedureImidazole was added to the cleared cell lysate to bring it to a final concentration of 5mM imidazole before loading onto 4 mL bed-volume of Ni-NTA agarose affinity resin (Qiagen #30250). The column was then washed with 50mL of binding buffer and 50mL of Wash buffer.The Ni-NTA resin was equilibrated in the thrombin cleavage buffer by washing 5-10mL over the resin. After this elution, the stopcock valve was closed. A 10mL volume of thrombin cleavage buffer and 20-40 Units of bovine plasma thrombin was added to the resin. The beads were rocked for 16hours at either 4 degrees or room temperature.The eluate was loaded onto an an XK 16x65 column packed with HighLoad Superdex 200 resin that was pre-equilibrated in gel filtration buffer (AKTAxpress, GE Healthcare). The gel filtration column was run at a flow rate of 1.5mL/min and 2mL fractions collected. Fractions were pooled and concentrated using a centrifugal filter device (Amicon YM10).
CrystallizationThe purified protein was crystallized using a combination of sitting and hanging drop vapor diffusion methods. Protein was mixed with an equal volume of reservoir solution, and the plate incubated at 4 or 18 ºC. Crystals were appropriately cryoprotected as indicated below and harvested into liquid nitrogen for data collection.Reservoir: 18.6% PEG 4000, 0.1M AmSO4, 0.1M Tris-HCl pH 8.5, 15%v/v isopropanol, 5mM ATP/MgCl; Cryo: 25% w/v glycerol

© 2003-2010 Structural Genomics Consortium. All rights reserved.