Useful Information
Please contact us for any questions or request for reagents.
Materials and Methods: HSPA1L (3GDQ)
| Structure | HSPA1L |
|---|---|
| PDB Code | 3GDQ |
| Entry clone source | Mammalian Gene Collection |
| SGC clone accession | HSPA1LA-k005 |
| Tag | N-terminal hexahistidine tag with integrated TEV protease cleavage site: mhhhhhhssgvdlgtenlyfq*sm |
| Construct sequence | mhhhhhhssgvdlgtenlyfq*smATAKGIAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPQNTVFDAKRLIGRKFNDPVVQADMKLWPFQVINEGGKPK VLVSYKGENKAFYPEEISSMVLTKLKETAEAFLGHPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDKGGQGERHVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLG GEDFDNRLVSHFVEEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSSTQANLEIDSLYEGIDFYTSITRARFEELCADLFRGTLEPVEKALRDAKMDKAKIHDIVLVGGSTRIPKVQRLLQDYFNG RDLNKSINPDEAVAYGAAVQAAILMGDK |
| Vector | pNIC-Bsa4 |
| Expression host | E.coli BL21(DE3) R3 pRARE, where R3 denotes a derivative of BL21(DE3) resistant to a strain of T1 bacteriophage (SGC Oxford) and the pRARE plasmid originating from the Rosetta strain (Novagen) supplies tRNAs for rare codons. |
| Growth method | Cells from glycerol stock were plated onto a LB agar plate with antibiotics and incubated at 37 ºC overnight. 10 colonies were used to inoculate 50 mL LB supplemented with 100 µg/mL kanamycin and 34 µg/mL chloramphenicol and grown at 37 ºC overnight. 15 mL of the overnight culture were added to 1.5 l TB supplemented with 8 g/l glycerol, 50 µg/mL kanamycin, 34 µg/mL chloramphenicol and approximately 0.3 mL 204 Antifoam A6426 (Sigma). The culture was grown in a LEX bioreactor system (Harbinger Biotechnology) at 37 ºC until OD600 reached ~2. The bottle was down-tempered to 18 ºC over a period of 1 hour before target expression was induced by addition of 0.5 mM IPTG. Expression was allowed to continue overnight and cells were harvested the following morning by centrifugation (4,500 x g, 15 min, 4 ºC). The resulting cell pellet (25.2 g wet cell weight) was resuspended in lysis buffer (2 mL/g cell pellet), supplemented with 0.5 tablet of Complete EDTA-free protease inhibitor (Roche Applied Science). The cell suspension was stored at -80 ºC. |
| Extraction buffers | Lysis buffer: 100 mM HEPES, 500 mM NaCl, 10% glycerol, 10 mM imidazole, 0.5 mM TCEP, pH 8.0 |
| Extraction procedure | The cell suspension was quickly thawed in water and 1000 U Benzonase (Merck) was added. Cells were disrupted by sonication (Vibra-Cell, Sonics) at 80% amplitude for 3 min effective time (pulsed 4s on, 4s off) and cell debris was removed by centrifugation (49,100 x g, 20 min, 4 ºC). The supernatant was decanted and filtered through a 0.45 µm flask filter. |
| Purification buffers | IMAC wash1 buffer: 20 mM HEPES, 500 mM NaCl, 10% glycerol, 10 mM imidazole, 0.5 mM TCEP, pH 7.5 IMAC wash2 buffer: 20 mM HEPES, 500 mM NaCl, 10% glycerol, 25 mM imidazole, 0.5 mM TCEP, pH 7.5 IMAC elution buffer: 20 mM HEPES, 500 mM NaCl, 10% glycerol, 500 mM imidazole, 0.5 mM TCEP, pH 7.5 Gel filtration (GF) buffer: 20 mM HEPES, 300 mM NaCl, 10% glycerol, 0.5 mM TCEP, pH 7.5 |
| Purification procedure | Columns IMAC: Ni-charged 1 mL HiTrap Chelating HP (GE Healthcare) Gel filtration column: HiLoad 16/60 Superdex 200 Prep Grade (GE Healthcare) Procedure |
| Crystallization | Crystals were obtained by the sitting drop vapour diffusion method using a 96-well plate. 0.2 µl of the protein sample (15.8 mg/mL) including 5 mM ADP and 5 mM MnCl2 was mixed with 0.1 µl of well solution consisting of 0.1 M Tris pH 8.5, 0.2 M trimethylamine n-oxide, 26% (w/v) PEG MME 2000. The plate was incubated at 4 ºC and crystals appeared within 2 days. For data collection crystals were quickly transferred to cryo solution consisting of well solution and 17% glycerol, and flash-frozen in liquid nitrogen. |
| Data collection | Data to 1.8 Å resolution was collected from a single crystal at DIAMOND (I03). The crystal belonged to space group P212121 with cell parameters a=70.1 Å, b=70.7 Å, c=97.5 Å, α= 90°, β=90°, γ= 90°. |
| Data processing | The structure was solved by molecular replacement using MOLREP with the bovine heat-shock cognate 70 kDa protein (1BA0) as a search model. The asymmetric unit consisted of one polypeptide chain with one ADP, a phosphate ion and a Mn2+ ion located in the active site of the enzyme. The structure was refined with REFMAC5. Final R-values were R=17.22% and Rfree=20.25%. The coordinates and structure factors were deposited in the PDB with accession code 3GDQ. |


