Useful Information
Please contact us for any questions or request for reagents.
Materials and Methods: ACOT4 (3K2I)
| Structure | ACOT4A |
|---|---|
| PDB Code | 3K2I |
| Entry clone accession | BC090945 |
| Entry clone source | Mammalian Gene Collection |
| SGC clone accession | ACOT4A-k012 |
| Tag | N-terminal hexahistidine tag with integrated TEV protease cleavage site: mhhhhhhssgvdlgtenlyfq*sm |
| Construct sequence | mhhhhhhssgvdlgtenlyfq*smSATLILEPPGRCCWNEPVRIAVRGLAPEQRVTLRASLRDEKGALFRAHARYCADACGELDLERAPALGGSFAGLEPMGLLWALEPEKPFWRFLKRDVQIPFVV ELEVLDGHDPEPGRLLCQAQHERHFLPPGVWRQSVRAGRVRATLFLPPGPGPFPGIIDIFGIGGGLLEYRASLLAGHGFATLALAYYNFEDLPNNMDNISLEYFEEAVCYMLQHPQVKGPGIGLLGI SLGADICLSMASFLKNVSATVSINGSGISGNTAINYKHSSIPPLGYDLRRIKVAFSGLVDIVDIRNALVGGYKNPSMIPIEKAQGPILLIVGQDDHNWRSELYAQTVSERLQAHGKEKPQIICYPGT GHYIEPPYFPLCPASLHRLLNKHVIWGGEPRAHSKAQEDAWKQILAFFCKHLGGTQKTAVPKL W in red bold indicates position of R-to-W mutation revealed by sequencing |
| Vector | pNIC-Bsa4 |
| Expression host | E.coli Rosetta 2 (Novagen) |
| Growth method | Cells from a glycerol stock were used to inoculate 40 mL LB supplemented with 50 µg/mL kanamycin and 34 μg/mL chloramphenicol, and grown at 30 ºC overnight. 2 x 15 mL of the overnight culture was used to inoculate 2 x 1.5 l TB supplemented with 8 g/l glycerol, 50 µg/mL kanamycin and approximately 5-10 drops of Dow Corning Antifoam. The culture was grown in a LEX bioreactor system (Harbinger Biotechnology) at 37 ºC until OD600 reached ~2. The culture was down-tempered to 18 ºC over a period of one hour before target expression was induced by addition of 0.5 mM IPTG. Expression was allowed to continue overnight and cells were harvested the following morning by centrifugation (4,400 x g, 10 min, 4 ºC). The resulting cell pellet (69.2 g wet cell weight) was resuspended in lysis buffer (2 mL/g cell pellet) supplemented with one tablets of Complete EDTA-free protease inhibitor (Roche Applied Science) and 2000 U Benzonase (Merck) per 100 mL lysis buffer, and stored at -80 ºC. |
| Extraction buffers | Lysis buffer: 100 mM HEPES, 500 mM NaCl, 10% glycerol, 10 mM imidazole, 0.5 mM TCEP, pH 8.0 |
| Extraction procedure | The cell suspension was quickly thawed in water. Cells were disrupted by sonication (VibraCell, Sonics) at 80% amplitude for 3 min effective time (puls 4s on, 4s off) and cell debris was removed by centrifugation (49,000 x g, 30 min, 4 ºC). The supernatant was decanted and filtered through a 0.45 µm flask filter. |
| Purification buffers | IMAC wash1 buffer: 20 mM HEPES, 500 mM NaCl, 10% glycerol, 10 mM imidazole, 0.5 mM TCEP, pH 7.5 IMAC wash2 buffer: 20 mM HEPES, 500 mM NaCl, 10% glycerol, 25 mM imidazole, 0.5 mM TCEP, pH 7.5 IMAC elution buffer: 20 mM HEPES, 500 mM NaCl, 10% glycerol, 500 mM imidazole, 0.5 mM TCEP, pH 7.5 Gel filtration (GF) buffer: 20 mM HEPES, 300 mM NaCl, 10% glycerol, 0.5 mM TCEP, pH 7.5 |
| Purification procedure | Columns IMAC: Ni-charged 5 mL HiTrap Chelating HP (GE Healthcare) Gel filtration column: HiLoad 16/60 Superdex 200 Prep Grade (GE Healthcare) Procedure |
| Crystallization | Native crystals were obtained by the sitting drop vapour diffusion method in a 96-well plate. 0.2 µl of the protein solution (14.0 mg/mL) including 2.5 mM acetyl CoA was mixed with 0.1 µl of well solution consisting of 0.2M sodium iodide, 0.1M Bis-Tris propane pH 8.5, 20% (w/v) PEG 3350. The plate was incubated at 4 ºC and crystals were obtained after 5 days. The crystals were quickly transferred to cryo solution containing well solution and 20% glycerol, and flash frozen in liquid nitrogen. |
| Data collection | Native data was collected to 2.4 Å at DIAMOND (I02). The crystal belonged to space group P 21 21 21 with cell parameters of a= 72.47 Å b=93.00 Å and c=133.72Å. |
| Data processing | Data integration was performed in imosflm and scaled with scala. Molecular replacement was done using molrep with model 3HLK. The asymmetric unit consisted of two chains. The structure was refined with Refmac5 with a final refinement cycle using phenix.refine. Final R-values were R= 19.25% and Rfree= 24.89% and coordinates and structure factors were deposited in the PDB with accession code 3K2I. |


